Cricetulus griseus (Chinese hamster): 100774182 Help Entry 100774182         CDS       T02813                                  Name (RefSeq) histone H4 isoform X2   KO K11254   histone H4 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04613   Neutrophil extracellular trap formation cge05034   Alcoholism cge05203   Viral carcinogenesis cge05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cge00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100774182  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100774182   09163 Immune disease    05322 Systemic lupus erythematosus     100774182   09165 Substance dependence    05034 Alcoholism     100774182  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100774182 Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100774182 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  100774182 NCBI-ProteinID:  XP_027265347 UniProt:  G3H2T6 LinkDB All DBs Position 3:complement(244839745..244840109) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgtggtaaaggcggaaaaggcctgggcaaaggtggcgccaagcgccaccgc aaagtcctccgcgacaacatccagggtatcactaagcccgccatccgccgcttggcccgc cgtggcggagtcaagcgcatctccggtctcatctacgaggagacccgtggggtgctgaag gtgttcctggagaacgtgatccgcgatgcggtcacctacacggagcacgccaagcgcaag accgtcaccgccatggacgtggtctacgcgctcaagcgccagggccgcacgctctatggc ttcggcggttaa

DBGET integrated database retrieval system