KEGG   Cricetulus griseus (Chinese hamster): 113838746
Entry
113838746         CDS       T02813                                 
Name
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04519  Cadherin signaling
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05207  Chemical carcinogenesis - receptor activation
cge05208  Chemical carcinogenesis - reactive oxygen species
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838746
   04012 ErbB signaling pathway
    113838746
   04014 Ras signaling pathway
    113838746
   04015 Rap1 signaling pathway
    113838746
   04370 VEGF signaling pathway
    113838746
   04371 Apelin signaling pathway
    113838746
   04068 FoxO signaling pathway
    113838746
   04072 Phospholipase D signaling pathway
    113838746
   04071 Sphingolipid signaling pathway
    113838746
   04151 PI3K-Akt signaling pathway
    113838746
   04150 mTOR signaling pathway
    113838746
  09133 Signaling molecules and interaction
   04519 Cadherin signaling
    113838746
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838746
   04137 Mitophagy - animal
    113838746
  09143 Cell growth and death
   04210 Apoptosis
    113838746
   04218 Cellular senescence
    113838746
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838746
   04550 Signaling pathways regulating pluripotency of stem cells
    113838746
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838746
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838746
   04650 Natural killer cell mediated cytotoxicity
    113838746
   04660 T cell receptor signaling pathway
    113838746
   04662 B cell receptor signaling pathway
    113838746
   04664 Fc epsilon RI signaling pathway
    113838746
   04062 Chemokine signaling pathway
    113838746
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838746
   04929 GnRH secretion
    113838746
   04912 GnRH signaling pathway
    113838746
   04915 Estrogen signaling pathway
    113838746
   04914 Progesterone-mediated oocyte maturation
    113838746
   04917 Prolactin signaling pathway
    113838746
   04921 Oxytocin signaling pathway
    113838746
   04926 Relaxin signaling pathway
    113838746
   04935 Growth hormone synthesis, secretion and action
    113838746
   04919 Thyroid hormone signaling pathway
    113838746
   04916 Melanogenesis
    113838746
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838746
  09156 Nervous system
   04725 Cholinergic synapse
    113838746
   04726 Serotonergic synapse
    113838746
   04720 Long-term potentiation
    113838746
   04730 Long-term depression
    113838746
   04722 Neurotrophin signaling pathway
    113838746
  09158 Development and regeneration
   04360 Axon guidance
    113838746
  09149 Aging
   04211 Longevity regulating pathway
    113838746
   04213 Longevity regulating pathway - multiple species
    113838746
  09159 Environmental adaptation
   04714 Thermogenesis
    113838746
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838746
   05206 MicroRNAs in cancer
    113838746
   05205 Proteoglycans in cancer
    113838746
   05207 Chemical carcinogenesis - receptor activation
    113838746
   05208 Chemical carcinogenesis - reactive oxygen species
    113838746
   05203 Viral carcinogenesis
    113838746
   05230 Central carbon metabolism in cancer
    113838746
   05231 Choline metabolism in cancer
    113838746
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838746
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838746
   05212 Pancreatic cancer
    113838746
   05225 Hepatocellular carcinoma
    113838746
   05226 Gastric cancer
    113838746
   05214 Glioma
    113838746
   05216 Thyroid cancer
    113838746
   05221 Acute myeloid leukemia
    113838746
   05220 Chronic myeloid leukemia
    113838746
   05218 Melanoma
    113838746
   05211 Renal cell carcinoma
    113838746
   05219 Bladder cancer
    113838746
   05215 Prostate cancer
    113838746
   05213 Endometrial cancer
    113838746
   05224 Breast cancer
    113838746
   05223 Non-small cell lung cancer
    113838746
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838746
   05170 Human immunodeficiency virus 1 infection
    113838746
   05161 Hepatitis B
    113838746
   05160 Hepatitis C
    113838746
   05163 Human cytomegalovirus infection
    113838746
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838746
   05165 Human papillomavirus infection
    113838746
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838746
   05022 Pathways of neurodegeneration - multiple diseases
    113838746
  09165 Substance dependence
   05034 Alcoholism
    113838746
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    113838746
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838746
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838746
   01522 Endocrine resistance
    113838746
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838746
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838746
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838746
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838746
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N TP0183_N nSTAND3 Septin
Other DBs
NCBI-GeneID: 113838746
NCBI-ProteinID: XP_035309626
UniProt: A0A9J7KG38
LinkDB
Position
Unknown
AA seq 189 aa
MTEHKLVVVGADGVGKSALTIQLIQYHFVDVYDPTIEDSYRKQVKIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNMKSFEAIHHYREQIKRVKDAEDLPMVLVGNKCDL
PSRAVDTNQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTSGR
VKNKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagcataaacttgtggtagttggagctgatggcgtaggcaagagtgccttgacg
atacagctaattcagtatcactttgtggatgtatacgatcctacaatagaggactcctac
aggaaacaagtaaaaattgatggagaaacctgtctcttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatatgaaatcgtttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagacgctgaggatttgcctatggtcctagtagggaataaatgtgatttg
ccttctagagcagtagacacaaatcaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagtacagattgaaaaaaatcagcaaagaagaaaagacttctggccgt
gtgaagaataaaaaatgcattgtaatgtaa

DBGET integrated database retrieval system