Carassius gibelio (silver crucian carp): 127933460 Help Entry 127933460         CDS       T08819                                  Name (RefSeq) mitoregulin-like   KO K29035   mitoregulin Organism cgib  Carassius gibelio (silver crucian carp) Brite KEGG Orthology (KO) [BR:cgib00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cgib03029]     127933460 Mitochondrial biogenesis [BR:cgib03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     127933460 SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom Inovirus_G7P_2 SPC12 Rhodo_GlycoT Motif Other DBs NCBI-GeneID:  127933460 NCBI-ProteinID:  XP_052386439 LinkDB All DBs Position A17 Genome browser AA seq 56 aa AA seqDB search MAEVSERTLQVALVVSFAAGFIAGWQANRMRRRFLDWRKKRLQDKLAETQKKLDLS NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggccgaggtgtcggagaggacgttacaggtcgctttagtcgtttcgtttgcggctggt ttcatcgccggttggcaggcaaacagaatgcgaagaaggttcttggactggcggaaaaag aggttacaagacaagctcgcagaaacacagaagaagctagacctgtcatga

DBGET integrated database retrieval system