Carassius gibelio (silver crucian carp): 127935331 Help Entry 127935331         CDS       T08819                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04382   Cornified envelope formation cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     127935331  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127935331  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgib04147]     127935331 Exosome [BR:cgib04147]  Exosomal proteins   Exosomal proteins of microglial cells    127935331 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  127935331 NCBI-ProteinID:  XP_052389072 LinkDB All DBs Position A19:complement(22320150..22321484) Genome browser AA seq 101 aa AA seqDB search MPSELETAMESLIMVFHSYAGKEGKSGSLTRRELRTLMENELSGFLKSQKDPTTIDRIMK DLDANGDGEVNFEEFVSLVVGLSIACEACYRMQLKKTQSWK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccatccgagctagagaccgccatggagtccctcatcatggtattccacagctacgct ggaaaagagggcaagagtggctccctgacccgccgtgaactccgaaccctgatggagaac gagctctctgggtttctcaagtctcaaaaggatccgactactatagacagaattatgaag gacttggatgccaatggagatggggaggtgaactttgaggagtttgtgtctttggttgtg ggtttgtccatcgcctgtgaagcgtgctacaggatgcagttaaagaagacacaaagctgg aaatga

DBGET integrated database retrieval system