Carassius gibelio (silver crucian carp): 127946728 Help Entry 127946728         CDS       T08819                                  Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04010   MAPK signaling pathway cgib04012   ErbB signaling pathway cgib04068   FoxO signaling pathway cgib04137   Mitophagy - animal cgib04140   Autophagy - animal cgib04144   Endocytosis cgib04150   mTOR signaling pathway cgib04210   Apoptosis cgib04218   Cellular senescence cgib04370   VEGF signaling pathway cgib04371   Apelin signaling pathway cgib04510   Focal adhesion cgib04540   Gap junction cgib04625   C-type lectin receptor signaling pathway cgib04810   Regulation of actin cytoskeleton cgib04910   Insulin signaling pathway cgib04912   GnRH signaling pathway cgib04916   Melanogenesis cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127946728    04012 ErbB signaling pathway     127946728    04370 VEGF signaling pathway     127946728    04371 Apelin signaling pathway     127946728    04068 FoxO signaling pathway     127946728    04150 mTOR signaling pathway     127946728  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127946728    04140 Autophagy - animal     127946728    04137 Mitophagy - animal     127946728   09143 Cell growth and death    04210 Apoptosis     127946728    04218 Cellular senescence     127946728   09144 Cellular community - eukaryotes    04510 Focal adhesion     127946728    04540 Gap junction     127946728   09142 Cell motility    04810 Regulation of actin cytoskeleton     127946728  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127946728   09152 Endocrine system    04910 Insulin signaling pathway     127946728    04912 GnRH signaling pathway     127946728    04916 Melanogenesis     127946728  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127946728  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cgib04131]     127946728   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgib04147]     127946728    04031 GTP-binding proteins [BR:cgib04031]     127946728 Membrane trafficking [BR:cgib04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     127946728  Endocytosis   Macropinocytosis    Ras GTPases     127946728 Exosome [BR:cgib04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    127946728   Exosomal proteins of colorectal cancer cells    127946728 GTP-binding proteins [BR:cgib04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127946728 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  127946728 NCBI-ProteinID:  XP_052399420 LinkDB All DBs Position A25:complement(14596923..14621183) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatacaagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatacgaccccactatagaggactcctac aggaagcaggtggtgattgacggagagacgtgtctcctggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtcttcgccatcaataacaccaagtcctttgaggacattcatcaatacagggaacagatc aagcgggtgaaggactcggatgatgtgcccatggtgctggtgggtaacaagtgtgacctc ccgacccggacggtggacacacggcaagcgcaggagctcgcccgcagctacgggatcccc ttcatcgagacctccgccaaaacacgacagggtgtggaggatgcgttttacacgctggtg cgagagatccgtcagcacaagatgaggaagctgaacccgccggacgagagcggacaggac tgcatgagctgccgctgcgtcgtgtcctga

DBGET integrated database retrieval system