Carassius gibelio (silver crucian carp): 127949206 Help Entry 127949206         CDS       T08819                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib03030   DNA replication cgib03410   Base excision repair cgib03420   Nucleotide excision repair cgib03430   Mismatch repair cgib03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cgib00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     127949206    03410 Base excision repair     127949206    03420 Nucleotide excision repair     127949206    03430 Mismatch repair     127949206    03440 Homologous recombination     127949206  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cgib03032]     127949206    03400 DNA repair and recombination proteins [BR:cgib03400]     127949206 DNA replication proteins [BR:cgib03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     127949206 DNA repair and recombination proteins [BR:cgib03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       127949206    MMR (mismatch excision repair)     DNA polymerase delta complex      127949206 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  127949206 NCBI-ProteinID:  XP_052402185 LinkDB All DBs Position B1:25431966..25434061 Genome browser AA seq 108 aa AA seqDB search MTPKRGLITDTFKVVKKARRGGKRDKSPPPPIAEPEPPQLSEREKDLQELKKFDLDYKFG PCTGISRMQRWERAALHGLNPPQEIKDILLKESTDPEYTQSLWRDYPL NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacacctaagcgtggcctcataaccgataccttcaaagttgtgaagaaggcaaggagg gggggcaagagagacaagtctcctccaccgccaatagcagagcctgagcccccacaactg agtgaaagagaaaaagatctacaagaactgaagaagtttgatctggactataaattcgga ccatgtacagggatcagtcgaatgcagagatgggagagggcagcactgcatgggctgaat cccccgcaggagattaaagacattttactgaaggagagcactgacccagagtacacacag agtctctggcgtgactatcccctctga

DBGET integrated database retrieval system