Carassius gibelio (silver crucian carp): 127953825 Help Entry 127953825         CDS       T08819                                  Name (RefSeq) insulin   KO K04526   insulin Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04010   MAPK signaling pathway cgib04068   FoxO signaling pathway cgib04081   Hormone signaling cgib04114   Oocyte meiosis cgib04140   Autophagy - animal cgib04150   mTOR signaling pathway cgib04810   Regulation of actin cytoskeleton cgib04910   Insulin signaling pathway cgib04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cgib00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127953825    04068 FoxO signaling pathway     127953825    04150 mTOR signaling pathway     127953825   09133 Signaling molecules and interaction    04081 Hormone signaling     127953825  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127953825   09143 Cell growth and death    04114 Oocyte meiosis     127953825   09142 Cell motility    04810 Regulation of actin cytoskeleton     127953825  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     127953825    04914 Progesterone-mediated oocyte maturation     127953825  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cgib04052]     127953825 Cytokines and neuropeptides [BR:cgib04052]  Neuropeptides   Unclassified    127953825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  127953825 NCBI-ProteinID:  XP_052409116 LinkDB All DBs Position B3:complement(20034074..20035588) Genome browser AA seq 110 aa AA seqDB search MASPGMLLLCLCAGSLVTHSGALGTRRLCGIQLVDALLLVCGEKGLFSQPARRVREHAFR VMMRSSVPFLWQTGATAPSGERGSVAKRGIVEQCCHFYCDYYDLENYCNT NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccagccctgggatgctgctgctgtgtctgtgtgccggctctctggtgacccacagc ggcgcgctcgggactcgaaggctgtgcgggatccagctcgtggacgcgctgctgctcgtc tgtggagagaagggtctcttctcccagcctgccaggcgggtcagagagcacgctttccgt gtcatgatgaggagcagtgtccccttcctgtggcagactggagcaactgctccgagtgga gagagaggttctgttgcaaagagaggcattgtggagcagtgctgtcatttctactgtgac tattacgacctggagaattactgtaacacatag

DBGET integrated database retrieval system