Carassius gibelio (silver crucian carp): 127956259 Help Entry 127956259         CDS       T08819                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04814   Motor proteins cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     127956259  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127956259  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cgib03037]     127956259    04812 Cytoskeleton proteins [BR:cgib04812]     127956259 Cilium and associated proteins [BR:cgib03037]  Motile cilia and associated proteins   Dynein arm    127956259 Cytoskeleton proteins [BR:cgib04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      127956259 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Gag_FV_central Motif Other DBs NCBI-GeneID:  127956259 NCBI-ProteinID:  XP_052410052 LinkDB All DBs Position B4:27711591..27713648 Genome browser AA seq 113 aa AA seqDB search MDDDPSAEETAFVVDEVSSIVKESLEAVIGRHPYEHKRVTQWVSSVEEQCLGQLSKLNKP FKYIVTCIIMQKNGAGLQSASSCFWDNTTDGSCTVRWENKHLYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgacgaccctagcgcggaagagacggcgttcgttgtggatgaagtgagcagcatc gtgaaggagtctctggaggcagtgatcggcagacacccgtatgaacacaagcgtgtgacc cagtgggtgtccagtgtggaggagcagtgcctcggtcagctcagcaaactcaacaaaccc ttcaaatacatcgtcacgtgtattataatgcagaaaaacggtgcaggactgcagtcggct tcgtcatgtttctgggacaatactacagatggcagctgcacggtccgatgggaaaacaaa cacttgtactgcatcgtcagtgtgttcggactcgccatctag

DBGET integrated database retrieval system