Carassius gibelio (silver crucian carp): 127957935 Help Entry 127957935         CDS       T08819                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04010   MAPK signaling pathway cgib04068   FoxO signaling pathway cgib04081   Hormone signaling cgib04114   Oocyte meiosis cgib04140   Autophagy - animal cgib04150   mTOR signaling pathway cgib04810   Regulation of actin cytoskeleton cgib04910   Insulin signaling pathway cgib04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cgib00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     127957935    04150 mTOR signaling pathway     127957935   09133 Signaling molecules and interaction    04081 Hormone signaling     127957935  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127957935  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cgib04052]     127957935 Cytokines and neuropeptides [BR:cgib04052]  Neuropeptides   Unclassified    127957935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Toxin_8 Motif Other DBs NCBI-GeneID:  127957935 NCBI-ProteinID:  XP_052412614 LinkDB All DBs Position B5:complement(31286826..31288125) Genome browser AA seq 109 aa AA seqDB search MAVWLQAGALLFLLAVSSVNANAGATQHLCGSHLVDALYLVCGPTGFFYNPKRDVVDPLL GFLPPKSAQETEVADFAFKDHAEPMRKRGIVEQCCHKPCSIFELQNYCN NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggcagtgtggctccaggctggtgctctgttgttcctgttggccgtctccagtgtgaat gctaatgcaggggccacgcagcacctgtgtggatcccatctggtcgatgccctctacctg gtctgtggtcctacaggcttcttctacaaccccaaaagagatgttgttgaccctcttctg ggtttccttcctccaaagtctgcccaggaaactgaggtggccgactttgcatttaaagat catgccgagccgatgaggaagagaggcattgtggagcagtgctgccacaaaccctgcagt atatttgaactgcagaattactgtaactaa

DBGET integrated database retrieval system