Carassius gibelio (silver crucian carp): 127962858 Help Entry 127962858         CDS       T08819                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04137   Mitophagy - animal cgib04140   Autophagy - animal cgib04144   Endocytosis cgib04145   Phagosome cgib04148   Efferocytosis cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127962858    04145 Phagosome     127962858    04140 Autophagy - animal     127962858    04137 Mitophagy - animal     127962858    04148 Efferocytosis     127962858  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127962858  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cgib04131]     127962858   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgib04147]     127962858    04031 GTP-binding proteins [BR:cgib04031]     127962858 Membrane trafficking [BR:cgib04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     127962858 Exosome [BR:cgib04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127962858   Exosomal proteins of other body fluids (saliva and urine)    127962858   Exosomal proteins of colorectal cancer cells    127962858   Exosomal proteins of bladder cancer cells    127962858 GTP-binding proteins [BR:cgib04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     127962858 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW PduV-EutP Septin nSTAND3 AAA_7 NTPase_1 AAA_16 AAA_22 G-alpha AAA_24 ATPase_2 SRPRB AAA_5 ABC_tran ATP-synt_ab AAA_14 NACHT MCM Motif Other DBs NCBI-GeneID:  127962858 NCBI-ProteinID:  XP_052418414 LinkDB All DBs Position B8:complement(24989409..24996065) Genome browser AA seq 204 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPTSFKTMDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVDQAFQTIARNALKQETVE TYDFPDQIKLRDDRPVSSSDGCSC NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgtcctctcgtaagaaggtgctgctcaaagtgatcatcctaggggattctggagttggg aagacctctctgatgaaccagtatgtgaataataagttcagcaatcagtacaaggccaca atcggagccgacttcctgactaaggaggtgatggtggacgacagactggtcaccatgcag atctgggacacggcgggacaggagcgctttcagtctctgggtgtggcgttttacaggggg gcggactgctgcgtgctggtgtacgacgtcacagcgccaacttcattcaagactatggac agctggagggacgagtttctcattcaggccagtcctcgtgacccggagaacttccccttt gttgtgctgggcaacaaaatcgacctggagaaccggcaggtaacgacaaagcgagcccaa gcgtggtgtcagagtaagaacaacatcccttatttcgagaccagtgccaaagaagccatt aacgtggaccaggccttccaaactatcgctcgcaatgctctcaaacaggagacggtggag acgtatgacttccctgaccagattaaactcagagacgacagacctgtgtctagcagtgat ggctgcagctgctga

DBGET integrated database retrieval system