Carassius gibelio (silver crucian carp): 127963616 Help Entry 127963616         CDS       T08819                                  Name (RefSeq) GTPase NRas-like   KO K07828   GTPase NRas Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04010   MAPK signaling pathway cgib04012   ErbB signaling pathway cgib04068   FoxO signaling pathway cgib04137   Mitophagy - animal cgib04140   Autophagy - animal cgib04150   mTOR signaling pathway cgib04210   Apoptosis cgib04218   Cellular senescence cgib04370   VEGF signaling pathway cgib04371   Apelin signaling pathway cgib04540   Gap junction cgib04625   C-type lectin receptor signaling pathway cgib04810   Regulation of actin cytoskeleton cgib04910   Insulin signaling pathway cgib04912   GnRH signaling pathway cgib04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cgib00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127963616    04012 ErbB signaling pathway     127963616    04370 VEGF signaling pathway     127963616    04371 Apelin signaling pathway     127963616    04068 FoxO signaling pathway     127963616    04150 mTOR signaling pathway     127963616  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127963616    04137 Mitophagy - animal     127963616   09143 Cell growth and death    04210 Apoptosis     127963616    04218 Cellular senescence     127963616   09144 Cellular community - eukaryotes    04540 Gap junction     127963616   09142 Cell motility    04810 Regulation of actin cytoskeleton     127963616  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127963616   09152 Endocrine system    04910 Insulin signaling pathway     127963616    04912 GnRH signaling pathway     127963616    04916 Melanogenesis     127963616  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cgib04131]     127963616   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgib04147]     127963616    04031 GTP-binding proteins [BR:cgib04031]     127963616 Membrane trafficking [BR:cgib04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     127963616  Endocytosis   Macropinocytosis    Ras GTPases     127963616 Exosome [BR:cgib04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127963616   Exosomal proteins of other body fluids (saliva and urine)    127963616   Exosomal proteins of breast cancer cells    127963616   Exosomal proteins of colorectal cancer cells    127963616 GTP-binding proteins [BR:cgib04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127963616 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  127963616 NCBI-ProteinID:  XP_052419582 LinkDB All DBs Position B8:complement(6898650..6911709) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNLKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagttagttgttgtgggagcaggtggtgttgggaagagtgctttaacc atccagctcattcaaaatcattttgtggatgaatatgaccctactattgaggactcttac aggaagcaggtggtgattgacggtgagacgtgtctgctggacatcctggacactgcaggt caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgt gtctttgccataaacaacctcaaatccttcgccgatgtgcatttgtacagagaacagatc aagcgtgtaaaggactccgatgatgttcccatggtcctagtagggaacaagtgcgatttg gccagaacggtggacaccaagcaagctcaggaacttgccagaagctacggcattgagttt gtagaaacttctgccaagaccagacagggggttgaggacgctttttacaccctcgtccgt gagatccgacattatcgcatgaaaaagctcaacagcagagaagacaggaagcagggctgt ctgggtgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system