Carassius gibelio (silver crucian carp): 127966878 Help Entry 127966878         CDS       T08819                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04137   Mitophagy - animal cgib04140   Autophagy - animal cgib04144   Endocytosis cgib04145   Phagosome cgib04148   Efferocytosis cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127966878    04145 Phagosome     127966878    04140 Autophagy - animal     127966878    04137 Mitophagy - animal     127966878    04148 Efferocytosis     127966878  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127966878  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cgib04131]     127966878   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgib04147]     127966878    04031 GTP-binding proteins [BR:cgib04031]     127966878 Membrane trafficking [BR:cgib04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     127966878 Exosome [BR:cgib04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127966878   Exosomal proteins of other body fluids (saliva and urine)    127966878   Exosomal proteins of colorectal cancer cells    127966878   Exosomal proteins of bladder cancer cells    127966878 GTP-binding proteins [BR:cgib04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     127966878 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 PduV-EutP nSTAND3 Septin AAA_16 AAA_7 AAA_22 AAA_24 NTPase_1 G-alpha AAA_5 DUF5992 SRPRB ATPase_2 ABC_tran NACHT AAA_14 NB-ARC ATP-synt_ab Motif Other DBs NCBI-GeneID:  127966878 NCBI-ProteinID:  XP_052424165 LinkDB All DBs Position B10:complement(21256256..21260240) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEMMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKSNIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPVSSGDSCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttctcgtaaaaaggtgcttctgaaggtgatcattctcggggattctggggttggg aagacttctttgatgaatcaatatgtcaataagaagttcagcaatcagtataaagccacc atcggtgcagactttcttaccaaggagatgatggtggatgaccgactggtgacgatgcag atctgggacacggcaggacaggagcgtttccagtctttgggtgtggctttttaccgcggg gcagactgctgcgtgctggtgtatgacgtgaccgcaccgaacaccttcaaaaccctggac agctggagggatgagttcctcattcaggccagccctcgagacccagagaacttccccttt gtagtgctcggcaacaaaatcgacctggagaacagacaggtgacaacgaaacgagcccag gcgtggtgtcagagcaaaagcaatatcccgtactttgagaccagcgcaaaagaggccatc aacgtggaccaagctttccaaacgattgctcgcaatgccctcaaacaggagtctgaggtg gagacgtacgacttcccagaccagatcaaactgagagatgacagacccgtgtcctctggt gacagctgcagctgctga

DBGET integrated database retrieval system