Carassius gibelio (silver crucian carp): 127967852 Help Entry 127967852         CDS       T08819                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04810   Regulation of actin cytoskeleton cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     127967852  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127967852 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  127967852 NCBI-ProteinID:  XP_052424548 LinkDB All DBs Position B11:11037055..11038913 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccggacaggaggatcccgtgcaaagggaaattcatcaagactgggcgaaccgtgaa tatatcgaagtgatcaccagcagcattaagaaaatagccgattttctcaactcctttgat atgtcctgcaggtcccgtttagccactttgaatgagaagcttactgctttggagaggagg attgagtacattgaagccagagtcacaaaaggggaaaccttgacttag

DBGET integrated database retrieval system