Carassius gibelio (silver crucian carp): 127971917 Help Entry 127971917         CDS       T08819                                  Name (RefSeq) preproinsulin b   KO K04526   insulin Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04010   MAPK signaling pathway cgib04068   FoxO signaling pathway cgib04081   Hormone signaling cgib04114   Oocyte meiosis cgib04140   Autophagy - animal cgib04150   mTOR signaling pathway cgib04810   Regulation of actin cytoskeleton cgib04910   Insulin signaling pathway cgib04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cgib00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127971917    04068 FoxO signaling pathway     127971917    04150 mTOR signaling pathway     127971917   09133 Signaling molecules and interaction    04081 Hormone signaling     127971917  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127971917   09143 Cell growth and death    04114 Oocyte meiosis     127971917   09142 Cell motility    04810 Regulation of actin cytoskeleton     127971917  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     127971917    04914 Progesterone-mediated oocyte maturation     127971917  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cgib04052]     127971917 Cytokines and neuropeptides [BR:cgib04052]  Neuropeptides   Unclassified    127971917 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  127971917 NCBI-ProteinID:  XP_052431205 LinkDB All DBs Position B14 Genome browser AA seq 107 aa AA seqDB search MVLLLQAAALVLLLASLPGSLSTPSQHLCGSNLVDALYLVCGPRGFFYSSRSRRDLETLL ALLSNLADYEVAEADPLKQKVMKMKRGIVERCCHRPCTIYQLEDYCS NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggtcctgttgctccaggcagcagcattagtcctgctgctggcctccctgcctggatca ctctcaactccatctcagcatctgtgcggctccaacctggtggacgcgctttaccttgtg tgtgggcctagaggcttcttttactccagcagaagcaggagggacctggagactttgctg gccttgctctcaaatttagcagattacgaagtagctgaggctgatcctttaaagcagaag gtgatgaagatgaagagagggattgtggaacggtgctgccacaggccctgcaccatctac cagctggaagactactgcagctga

DBGET integrated database retrieval system