Carassius gibelio (silver crucian carp): 127974577 Help Entry 127974577         CDS       T08819                                  Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04010   MAPK signaling pathway cgib04144   Endocytosis cgib04370   VEGF signaling pathway cgib04510   Focal adhesion cgib04520   Adherens junction cgib04530   Tight junction cgib04810   Regulation of actin cytoskeleton cgib04912   GnRH signaling pathway cgib05100   Bacterial invasion of epithelial cells cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127974577    04370 VEGF signaling pathway     127974577  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127974577   09144 Cellular community - eukaryotes    04510 Focal adhesion     127974577    04520 Adherens junction     127974577    04530 Tight junction     127974577   09142 Cell motility    04810 Regulation of actin cytoskeleton     127974577  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     127974577  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127974577    05100 Bacterial invasion of epithelial cells     127974577  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cgib04131]     127974577    03036 Chromosome and associated proteins [BR:cgib03036]     127974577   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgib04147]     127974577    04031 GTP-binding proteins [BR:cgib04031]     127974577 Membrane trafficking [BR:cgib04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     127974577  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     127974577   Macropinocytosis    Ras GTPases     127974577 Chromosome and associated proteins [BR:cgib03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     127974577 Exosome [BR:cgib04147]  Exosomal proteins   Exosomal proteins of microglial cells    127974577   Exosomal proteins of breast milk    127974577 GTP-binding proteins [BR:cgib04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     127974577 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  127974577 NCBI-ProteinID:  XP_052433906 LinkDB All DBs Position B16:complement(21292777..21300606) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR DDSNTVEKLAKNKQRPISPESGEKLSRDLRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaagtgtgtggtggttggagatggagctgtcggaaagacctgcctcctc atctcatacacaaccaacaaattcccctctgaatatgttcccacggtttttgataactat gctgtaacagtgatgattggaggtgaaccgtatacactggggctttttgacacagcaggt caggaagactacgacagacttcggcctctcagctatccgcagaccgacgtcttccttgtt tgcttctcggttgtttctccttcctcctttgagaatgtgaaagagaagtgggtaccagag atctctcaccactgtccacgcactccattccttctggtgggcactcaggttgacttgagg gatgacagtaacactgtggaaaaacttgccaaaaacaagcagcgccccatttcacctgag agcggggagaagctgtccagagacctcagagctgtcaaatacgtggagtgctccgccctc acacagagaggcctgaagaatgtatttgacgaggcgatactcgccgcccttgaacctcca gagaccaaacccaagaagcgctgcgtccttttgtag

DBGET integrated database retrieval system