Carassius gibelio (silver crucian carp): 127985686 Help Entry 127985686         CDS       T08819                                  Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04145   Phagocytosis cgib04517   IgSF CAM signaling cgib04814   Motor proteins cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     127985686  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     127985686   09142 Cell motility    04814 Motor proteins     127985686  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127985686  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cgib03037]     127985686    04812 Cytoskeleton proteins [BR:cgib04812]     127985686 Cilium and associated proteins [BR:cgib03037]  Motile cilia and associated proteins   Dynein arm    127985686 Cytoskeleton proteins [BR:cgib04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      127985686 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  127985686 NCBI-ProteinID:  XP_052443700 LinkDB All DBs Position B21 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcagtaataaagaacgctgacatgtcggaggacatgcagcaggat gcagtggattgtgccacacaggccatggagaagtacaacattgagaaggacattgctgca tatatcaaaaaggagttcgataagaagtataatccgacatggcattgtattgtgggacgg aactttggcagttatgtgacacatgaaactaagcatttcatctacttttacttgggtcaa gtggctattctgctcttcaaatcaggctga

DBGET integrated database retrieval system