Carassius gibelio (silver crucian carp): 127987758 Help Entry 127987758         CDS       T08819                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04137   Mitophagy - animal cgib04140   Autophagy - animal cgib04144   Endocytosis cgib04145   Phagosome cgib04148   Efferocytosis cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127987758    04145 Phagosome     127987758    04140 Autophagy - animal     127987758    04137 Mitophagy - animal     127987758    04148 Efferocytosis     127987758  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127987758  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cgib04131]     127987758   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgib04147]     127987758    04031 GTP-binding proteins [BR:cgib04031]     127987758 Membrane trafficking [BR:cgib04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     127987758 Exosome [BR:cgib04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127987758   Exosomal proteins of other body fluids (saliva and urine)    127987758   Exosomal proteins of colorectal cancer cells    127987758   Exosomal proteins of bladder cancer cells    127987758 GTP-binding proteins [BR:cgib04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     127987758 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NB-ARC NACHT AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  127987758 NCBI-ProteinID:  XP_052446123 LinkDB All DBs Position B22:7302745..7310671 Genome browser AA seq 199 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQVCLL KYMLHLVTKALKYAYEQCT NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagttcttctgaaggtgatcattcttggagactctggggttggg aagacatctctgatgaaccagtatgtgaataagaagttcagtaatcagtacaaagctact ataggggcagatttcctgacaaaagaagtgatggttgatgaccgacttgtcacaatgcag atatgggacacagcaggtcaagagcgcttccagtctctgggtgtggctttctaccgcggt gccgactgctgtgtgctggtgttcgacgtcactgccccaaacaccttcaagacactggac agctggagagacgagtttctcatccaggccagcccgcgcgacccagagaacttccccttc gtggtgctgggcaacaaaatcgatctggagaacaggcaggtaacaactaagcgggcacag gcttggtgtcagagtaagaacaacatcccgtattttgagaccagtgcaaaggaggccatc aacgtagagcaggctttccagaccatcgcgcgcaatgcactcaaacaggtatgtttgttg aaatacatgttgcatttggtgacgaaagcactaaaatatgcttacgaacagtgcacttga

DBGET integrated database retrieval system