Carassius gibelio (silver crucian carp): 127988271 Help Entry 127988271         CDS       T08819                                  Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism cgib  Carassius gibelio (silver crucian carp) Brite KEGG Orthology (KO) [BR:cgib00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cgib03037]     127988271 Cilium and associated proteins [BR:cgib03037]  Primary cilia and associated proteins   BBSome    127988271 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 Ribosomal_S10 Motif Other DBs NCBI-GeneID:  127988271 NCBI-ProteinID:  XP_052446895 LinkDB All DBs Position B22:31571884..31573392 Genome browser AA seq 74 aa AA seqDB search MPEVKSMFREVLPKQGQLSVEDVPTMVLCKPKLLPLKSVTLEKLEKMQQDAQEIIKQQEL ALKEQQPQPPERAE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgcctgaagtgaaatcaatgtttcgagaggttctgcctaaacaaggtcagctctccgtg gaggacgttcccaccatggtcctgtgcaaacccaaactcctgcctctgaagtctgtgacg ctggagaaactggagaagatgcagcaggacgctcaggagatcatcaaacaacaggagctg gctttgaaggagcagcagccgcagccgcctgagagagcagagtag

DBGET integrated database retrieval system