Carassius gibelio (silver crucian carp): 128013305 Help Entry 128013305         CDS       T08819                                  Name (RefSeq) elongin-C-like isoform X1   KO K03872   elongin-C Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cgib00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     128013305  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cgib04121]     128013305    03400 DNA repair and recombination proteins [BR:cgib03400]     128013305 Ubiquitin system [BR:cgib04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      128013305    Cul5 complex      128013305 DNA repair and recombination proteins [BR:cgib03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      128013305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  128013305 NCBI-ProteinID:  XP_052452161 LinkDB All DBs Position B24:complement(14058246..14060610) Genome browser AA seq 113 aa AA seqDB search MADVEDRTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNE VNFREIPSHVLSKVSMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttgaagacaggacttacggtggttgtgaagggccggatgccatgtatgta aagttgatctcttcagatggccatgagtttattgtgaagagagagcacgctttaacctct ggcaccatcaaggctatgctgagtggacctggtcaattcgctgaaaatgaaaccaatgag gtgaacttccgggagatcccgtctcatgttctctccaaagtgagcatgtattttacctat aaagtgcgctacactaacagctcgacagaaatcccagaattccccattgctcctgagatt gccttggaattgctcatggctgcgaactttcttgactgttag

DBGET integrated database retrieval system