Carassius gibelio (silver crucian carp): 128016609 Help Entry 128016609         CDS       T08819                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04010   MAPK signaling pathway cgib04012   ErbB signaling pathway cgib04068   FoxO signaling pathway cgib04137   Mitophagy - animal cgib04140   Autophagy - animal cgib04144   Endocytosis cgib04150   mTOR signaling pathway cgib04210   Apoptosis cgib04218   Cellular senescence cgib04370   VEGF signaling pathway cgib04371   Apelin signaling pathway cgib04510   Focal adhesion cgib04540   Gap junction cgib04625   C-type lectin receptor signaling pathway cgib04810   Regulation of actin cytoskeleton cgib04910   Insulin signaling pathway cgib04912   GnRH signaling pathway cgib04916   Melanogenesis cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128016609    04012 ErbB signaling pathway     128016609    04370 VEGF signaling pathway     128016609    04371 Apelin signaling pathway     128016609    04068 FoxO signaling pathway     128016609    04150 mTOR signaling pathway     128016609  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128016609    04140 Autophagy - animal     128016609    04137 Mitophagy - animal     128016609   09143 Cell growth and death    04210 Apoptosis     128016609    04218 Cellular senescence     128016609   09144 Cellular community - eukaryotes    04510 Focal adhesion     128016609    04540 Gap junction     128016609   09142 Cell motility    04810 Regulation of actin cytoskeleton     128016609  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128016609   09152 Endocrine system    04910 Insulin signaling pathway     128016609    04912 GnRH signaling pathway     128016609    04916 Melanogenesis     128016609  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128016609  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cgib04131]     128016609   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgib04147]     128016609    04031 GTP-binding proteins [BR:cgib04031]     128016609 Membrane trafficking [BR:cgib04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     128016609  Endocytosis   Macropinocytosis    Ras GTPases     128016609 Exosome [BR:cgib04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    128016609   Exosomal proteins of colorectal cancer cells    128016609 GTP-binding proteins [BR:cgib04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128016609 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  128016609 NCBI-ProteinID:  XP_052457214 LinkDB All DBs Position A7:13080133..13085983 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PAHTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQG CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagttagtggtggttggtgcaggtggtgtgggcaagagtgctctgacc atccagctcatccagaaccactttgtggatgaatacgacccaaccattgaggactcgtat aggaaacaggtggtgattgatggagagacgtgtctgttggatatcctggatactgcaggt caggaagagtatagtgcaatgagagaccagtacatgaggaccggagagggctttctctgt gtctttgccatcaacaataccaagtcttttgaggacattcatcagtacagggaacagatt aagagggttaaagactccgatgatgtgcctatggtgcttgtgggtaataaatgtgactta ccagcgcacaccgtggacacgagacaagcccaggaactcgcccgtagctacggtataccc tacattgaaacctcagccaagacgagacagggagtggaagatgccttttacactcttgtc cgtgaaatcaggcagcataagctgaggaaactgaacccgcctgatgataatggccaaggc tgtatgaactgccgctgtgtggtgtcatga

DBGET integrated database retrieval system