Carassius gibelio (silver crucian carp): 128022436 Help Entry 128022436         CDS       T08819                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04137   Mitophagy - animal cgib04140   Autophagy - animal cgib04144   Endocytosis cgib04145   Phagosome cgib04148   Efferocytosis cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128022436    04145 Phagosome     128022436    04140 Autophagy - animal     128022436    04137 Mitophagy - animal     128022436    04148 Efferocytosis     128022436  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128022436  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cgib04131]     128022436   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgib04147]     128022436    04031 GTP-binding proteins [BR:cgib04031]     128022436 Membrane trafficking [BR:cgib04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     128022436 Exosome [BR:cgib04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128022436   Exosomal proteins of other body fluids (saliva and urine)    128022436   Exosomal proteins of colorectal cancer cells    128022436   Exosomal proteins of bladder cancer cells    128022436 GTP-binding proteins [BR:cgib04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     128022436 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  128022436 NCBI-ProteinID:  XP_052465985 LinkDB All DBs Position A11:14731102..14742329 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcaaggaagaaagttcttctgaaggtgatcatccttggagactccggggttggg aagacatctctgatgaaccagtatgtgaataagaagttcagtaatcagtacaaagctact ataggagcagatttcctgacaaaagaagtgatggttgatgaccgacttgtcacaatgcag atatgggacacagcaggtcaagagcggttccagtctctgggagtagctttctaccgcggt gccgactgctgtgtgctggtgttcgacgtcactgccccaaacaccttcaagacactggac agctggagggatgagttcctgatccaggccagcccacgggacccagagaacttccctttt gtggtgctgggcaacaaaatcgatctggagaataggcaggtaacaaccaagcgggcacag gcttggtgtcagagtaagaacaacatcccgtactttgagaccagtgcaaaggaggccatc aatgtagagcaggctttccagaccatcgcacgcaatgcactcaaacaggaaaccgaagtg gagttatacaacgagttccctgagccaattaaactagaccggaacgatagagccaagcca tcagcagagtcttgtagctgctga

DBGET integrated database retrieval system