Carassius gibelio (silver crucian carp): 128027077 Help Entry 128027077         CDS       T08819                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04010   MAPK signaling pathway cgib04068   FoxO signaling pathway cgib04081   Hormone signaling cgib04114   Oocyte meiosis cgib04140   Autophagy - animal cgib04150   mTOR signaling pathway cgib04810   Regulation of actin cytoskeleton cgib04910   Insulin signaling pathway cgib04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cgib00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     128027077    04150 mTOR signaling pathway     128027077   09133 Signaling molecules and interaction    04081 Hormone signaling     128027077  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128027077  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cgib04052]     128027077 Cytokines and neuropeptides [BR:cgib04052]  Neuropeptides   Unclassified    128027077 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  128027077 NCBI-ProteinID:  XP_052470351 LinkDB All DBs Position A14:4306752..4307942 Genome browser AA seq 120 aa AA seqDB search MPGSTCSQLQPIMVLLLQAAAIILLLASLSGSRSTPSQHLCGSSLVDALYLVCGPRGFFY SSRSRRDLETLLTLLSKLADYEVAQTDPLKQKVMMKMKRGIVERGCHRPCIIYHLEDYCI NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgccaggcagtacatgttcacagcttcagcccatcatggtcctgttgctccaggcagca gcaataatcctgctgctggcctccctgtctggatcacgctctaccccatcacagcatctg tgcggctccagcctggtggacgcactttaccttgtgtgtgggcctagaggcttcttttac tccagcagaagcaggagggacctggagactttgctgaccttgctctcaaaattagcagat tatgaggtagcccagactgatccattaaaacagaaggtgatgatgaagatgaagagaggc attgtggaacgaggctgccacaggccctgtatcatctaccacctggaggactactgcatc tga

DBGET integrated database retrieval system