Carassius gibelio (silver crucian carp): 128030969 Help Entry 128030969         CDS       T08819                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism cgib  Carassius gibelio (silver crucian carp) Pathway cgib04382   Cornified envelope formation cgib05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgib00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     128030969  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128030969  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgib04147]     128030969 Exosome [BR:cgib04147]  Exosomal proteins   Exosomal proteins of microglial cells    128030969 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EH EF-hand_8 Motif Other DBs NCBI-GeneID:  128030969 NCBI-ProteinID:  XP_052475028 LinkDB All DBs Position A16:14265619..14266388 Genome browser AA seq 103 aa AA seqDB search MPSDLERAMETLITVFHRYAGNEGNTSTLSRKELKLLMETELASFMKSQRDPAAVEKIMK DLDGNGDGEVDFEEFVALVVGLSVACEQFYKLHMQKTGGFKKQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgatctggagagagcgatggagacgctgatcacagtgtttcaccgttatgca ggcaatgaaggaaatacatcaacattaagtcgcaaagagctcaaactgctgatggagacc gagttggccagctttatgaagtctcagagggaccctgctgccgtagagaagattatgaag gatttggatggtaatggtgatggagaggtggattttgaagagtttgtggctcttgtggtg ggcctgtccgtggcctgtgaacaattctacaagctgcacatgcagaagacagggggtttc aaaaagcaataa

DBGET integrated database retrieval system