Colletes gigas: 122400164 Help Entry 122400164         CDS       T07492                                  Name (RefSeq) LIRP-like   KO K04526   insulin Organism cgig  Colletes gigas Pathway cgig04068   FoxO signaling pathway cgig04081   Hormone signaling cgig04140   Autophagy - animal cgig04150   mTOR signaling pathway cgig04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:cgig00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     122400164    04150 mTOR signaling pathway     122400164   09133 Signaling molecules and interaction    04081 Hormone signaling     122400164  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122400164  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     122400164  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cgig04052]     122400164 Cytokines and neuropeptides [BR:cgig04052]  Neuropeptides   Unclassified    122400164 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin SecG Motif Other DBs NCBI-GeneID:  122400164 NCBI-ProteinID:  XP_043257413 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MFAYQLHVIVSLILVIAILMPETEHAQSVVFQYRLKRQAENEGRKYCGSNLASTLRMICG SVYNSRFKKNIPEMEMDYGFNKDMHPYKSIESARKMLRFRRNSLGIYQECCLKTCSTQEL RSYCGSR NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgttcgcgtaccaattacacgtgatcgtgagtttgatactcgtaatagcgattctaatg ccagaaacggaacacgcgcaatcggttgtatttcagtacagattaaagcgacaggctgaa aacgaagggcgcaaatattgcggcagtaatcttgcaagcactctgcgaatgatctgtggt agcgtttacaattcccggttcaaaaaaaatattccagaaatggaaatggactatggattt aataaagatatgcatccttataaatccatcgagagcgctagaaaaatgttaagatttcgg agaaattcattgggtatctaccaagagtgctgcctaaaaacgtgttcaacacaagagctg cgctcctactgcggtagtcgttga

DBGET integrated database retrieval system