KEGG   Colletes gigas: 122400970
Entry
122400970         CDS       T07492                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
cgig  Colletes gigas
Pathway
cgig00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:cgig00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    122400970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cgig00199]
    122400970
Enzymes [BR:cgig01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     122400970
Cytochrome P450 [BR:cgig00199]
 Cytochrome P450, animal type
  CYP306 family
   122400970
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 122400970
NCBI-ProteinID: XP_043258718
LinkDB
Position
Unknown
AA seq 496 aa
MSLAYAILLASLFLLAYFFVRNRRRMRRLPPGPWQLPILGYLPWIDTEKPHESLTKLART
YGPICGLRMGSVYTVLLSDPRIIKQAFAMDACAGRAPLYLTHGIMQGYGLVCAEGNRWRD
QRKFVSICLRNFGMVKHDGPKRDRLEKRILDAANECVSKLEQRSTDGPIDPLDTLHHCMG
NLINSIVFGKTYEENEQVWKWLRHLQEEGVKHIGIAGPLNFLPILRLLPRYGQTIRHILD
GKEKTHRVYRGILDEHRARTAPTTPGNESFLAAFDEQMRKENTDDSYFTESQLYHLLADL
FGAGTDTTLTTLRWFLLFIAVHPDEQEKLRLEMDRCLDAGEEPTLKDRDSMPCFEAALAE
VQRLRSVAPLGIPHGTLEDTQIGEYDVPKGAMIVPVQWAVHTDPAYWQDPLEYRPDRFLA
EDGTFFKPESFLPFQTGKRVCVGEELARMILFLFAARILRALNISVPSNETVDLEGDCGI
TLVPKPHRLMFVARHR
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgagtctcgcctacgctatcctgctcgcgtctctctttcttctcgcgtattttttcgtc
agaaatcgcagaagaatgcgccgcctccctcccggaccctggcagcttccgatccttggc
taccttccgtggatcgacacggagaaaccgcacgaaagtctcacgaaactggccagaact
tacggccccatctgcgggcttcgtatgggttcggtctatactgttctcctctcggacccg
cgaataatcaagcaggctttcgcgatggacgcgtgcgccggcagagctccactgtacctc
actcacggaattatgcaaggatacggactggtttgcgccgaaggcaaccgatggagggac
caaaggaaattcgttagtatctgtttgagaaatttcgggatggtgaagcacgatggaccg
aagagagacagattggagaagaggatactggacgccgcgaacgaatgcgtatcgaaactc
gagcaacgatcgacggacgggccgatcgatcccttggacacgctccatcactgcatgggc
aatctgatcaacagcatcgttttcgggaaaacgtacgaggagaacgagcaggtttggaaa
tggttgagacacttgcaagaggagggagtgaagcatataggcatcgctggaccgctcaac
tttttgcctatcctcagattgttgccgcgatacggacaaacgatacgacacatcctcgac
ggaaaggagaagacgcaccgagtatatcgcggtatactcgatgaacatcgtgccaggacc
gcgccaacaaccccaggaaacgaaagcttcttggcggcgttcgatgaacagatgagaaag
gagaacacggacgatagttattttacggagtcgcaactttatcatttgttggctgaccta
ttcggcgctggaacggacacaactttgacgaccctccggtggtttctgcttttcatcgcc
gtacatccggatgaacaggagaaacttcggttagagatggatcggtgtttggatgccggt
gaagaaccgactttgaaggacagagactccatgccatgcttcgaagctgctttggccgaa
gtgcaacgactcagaagcgtcgccccactcggtattccccacggaacgttggaggatacg
caaataggcgaatacgacgtgccgaaaggggccatgatcgtgccggtgcaatgggccgtt
cataccgatcctgcttactggcaggatccactcgagtatcgacccgacagattcctggcc
gaggatggaaccttcttcaagccggaatcgtttcttccctttcagaccgggaaacgcgtc
tgcgtcggggaggaactggcccggatgatactgtttctcttcgctgctagaatattgcgc
gcgttgaatatatcggtaccgtcgaacgaaacggtcgatctcgaaggcgattgcggcatc
acgctcgtcccgaaaccacaccgattgatgttcgttgcgcgacatcgatga

DBGET integrated database retrieval system