Cotesia glomerata: 123266612 Help Entry 123266612         CDS       T07738                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism cglo  Cotesia glomerata Pathway cglo03030   DNA replication cglo03082   ATP-dependent chromatin remodeling cglo03410   Base excision repair cglo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cglo00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     123266612    03410 Base excision repair     123266612    03420 Nucleotide excision repair     123266612   09126 Chromosome    03082 ATP-dependent chromatin remodeling     123266612  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cglo03032]     123266612    03036 Chromosome and associated proteins [BR:cglo03036]     123266612    03400 DNA repair and recombination proteins [BR:cglo03400]     123266612 Enzymes [BR:cglo01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      123266612 DNA replication proteins [BR:cglo03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     123266612 Chromosome and associated proteins [BR:cglo03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     123266612 DNA repair and recombination proteins [BR:cglo03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       123266612 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C DMP19 EPS8_2nd Motif Other DBs NCBI-GeneID:  123266612 NCBI-ProteinID:  XP_044586855 LinkDB All DBs Position LG6:complement(20465979..20466733) Genome browser AA seq 124 aa AA seqDB search MAEKLEDLNLPNAVVTRIIKEALPEGVTIGKEAKVAVAKAASIFILYLTTSANTVAKKTN RKTITGPDVLQAMEDIEFDRFVDSLQDALNNFRKSQKEKKDASKKKTQKPDDKDSNEVEM IDDE NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggctgaaaaattagaagatctgaatctacctaatgcagtggtgactcgaattataaaa gaagcgcttccagaaggagtgacaatcggtaaggaggccaaagtagctgtcgcgaaagcg gcgtctattttcatcttgtacctgacaacctcagcgaacaccgtcgccaagaaaactaac cggaaaacaataacgggtccagatgtcctgcaagccatggaggacattgagtttgacagg ttcgtagactcgctccaggacgcgctcaacaatttccgcaagtcacagaaagagaagaag gacgcgagtaagaaaaagacccagaagcctgatgacaaagacagcaacgaggtggaaatg attgatgacgagtaa

DBGET integrated database retrieval system