Cotesia glomerata: 123271363 Help Entry 123271363         CDS       T07738                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism cglo  Cotesia glomerata Brite KEGG Orthology (KO) [BR:cglo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:cglo03041]     123271363   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cglo04052]     123271363 Spliceosome [BR:cglo03041]  Complex B   Other components    Complex B specific factors     123271363 Cytokines and neuropeptides [BR:cglo04052]  Neuropeptides   Unclassified    123271363 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ubiquitin_2 ubiquitin OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  123271363 NCBI-ProteinID:  XP_044593604 LinkDB All DBs Position LG9:complement(255924..258945) Genome browser AA seq 73 aa AA seqDB search MLEITCNDRLGKKVRVKCNPDDTIGDLKKLISAQTGTNWEKIVLKKWYTIYKDHIKLQDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgttggagatcacatgcaacgaccgtctcggaaaaaaagtacgagtaaagtgtaaccca gatgacacaattggggacctgaaaaaattgatctccgcgcaaactggcaccaactgggag aagatagttttaaaaaaatggtacactatctacaaggaccatataaagctccaggactac gagattcatgacgggatgaacctggagctttattatcaataa

DBGET integrated database retrieval system