Chryseobacterium gallinarum: OK18_11275
Help
Entry
OK18_11275 CDS
T03954
Name
(GenBank) phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
cgn
Chryseobacterium gallinarum
Pathway
cgn00770
Pantothenate and CoA biosynthesis
cgn01100
Metabolic pathways
cgn01240
Biosynthesis of cofactors
Module
cgn_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
cgn00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
OK18_11275
Enzymes [BR:
cgn01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
OK18_11275
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
AKK73118
UniProt:
A0A0G3M537
LinkDB
All DBs
Position
complement(2505667..2506131)
Genome browser
AA seq
154 aa
AA seq
DB search
MKIAVFPGSFDPITLGHYDIIERAAPLFDKLIIAIGQNSQKKYMFPLEKRMEFIQNSVAE
FPNVEVDYFEGLTVDYCFEKNAQYIIRGLRNPADFEFEKAIAHTNRTLAHKKLETVFLLT
SSGKSFISSSIVREIINHGGEYELLVPDSVRVER
NT seq
465 nt
NT seq
+upstream
nt +downstream
nt
atgaaaattgctgttttcccagggtcatttgatccgattacattaggacattacgatatc
atagaaagagcggcaccgctatttgataaactgattattgccatcggacagaattcccag
aagaaatatatgtttccattagaaaaaagaatggaatttattcaaaactctgtagcagaa
tttcccaatgtagaagtagattattttgagggacttaccgttgattattgctttgaaaaa
aatgcccaatacatcatcagaggattgagaaatcccgctgactttgaatttgaaaaagcc
atcgctcacaccaacaggacccttgcccataaaaaattggaaaccgttttcctgcttacc
tcttccggaaaatctttcatcagcagcagcattgtgagagagattatcaatcacggagga
gagtatgaactcttggttccggattcggtaagagtcgaaaggtaa
DBGET
integrated database retrieval system