Cottoperca gobio: 115003777 Help Entry 115003777         CDS       T07513                                  Symbol dynlt1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism cgob  Cottoperca gobio Pathway cgob04814   Motor proteins cgob05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgob00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     115003777 (dynlt1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115003777 (dynlt1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cgob03037]     115003777 (dynlt1)    04812 Cytoskeleton proteins [BR:cgob04812]     115003777 (dynlt1) Cilium and associated proteins [BR:cgob03037]  Motile cilia and associated proteins   Dynein arm    115003777 (dynlt1) Cytoskeleton proteins [BR:cgob04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      115003777 (dynlt1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 PTP2 Motif Other DBs NCBI-GeneID:  115003777 NCBI-ProteinID:  XP_029281556 UniProt:  A0A6J2P858 LinkDB All DBs Position 24:complement(7534729..7536664) Genome browser AA seq 116 aa AA seqDB search MVAMEEYQTEEESAFVVEEVKKVTKESVEAAIGGNAYQHSRVNQWTTSVVEQCLSQLSKL GKPFKYIVTCIIMQKNGAGLQTASTCFWDNSTDGSCVVRWENKSMYCIVSVFGLAI NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggtagcaatggaggagtatcagactgaagaggagagtgcgtttgtcgttgaagaagtg aaaaaagtcaccaaagagtcagtagaagcagccataggaggaaatgcctaccagcacagc cgagtgaaccagtggaccaccagtgtagtggagcagtgcctcagtcaactcagcaagctg gggaagccttttaaatatattgtaacttgtatcatcatgcagaaaaatggagcaggtctg caaacagccagcacatgcttctgggacaactcaactgatggaagctgtgtggtgagatgg gaaaacaagtccatgtactgcatcgtcagtgtttttgggctggccatctaa

DBGET integrated database retrieval system