Cottoperca gobio: 115007067 Help Entry 115007067         CDS       T07513                                  Name (RefSeq) C-C motif chemokine 25-like   KO K13072   C-C motif chemokine 25 Organism cgob  Cottoperca gobio Pathway cgob04060   Cytokine-cytokine receptor interaction cgob04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:cgob00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     115007067  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     115007067  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cgob04052]     115007067 Cytokines and neuropeptides [BR:cgob04052]  Cytokines   Chemokines    115007067 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Peptidase_C65 Motif Other DBs NCBI-GeneID:  115007067 NCBI-ProteinID:  XP_029285612 Ensembl:  ENSCGOG00000003899 UniProt:  A0A6J2PKI9 LinkDB All DBs Position 4:complement(25968226..25970787) Genome browser AA seq 98 aa AA seqDB search MKFQALFFLLILTCMYLSLAQGSYGNCCLGHVTGMKANVKRNIESYRMQETDGDCNIRAV VFLMKKKPLHKTQKTRCADPNQGWVQDVIRAVIARNQI NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaagttccaagctctgttctttcttctgatcctcacctgcatgtacctgagcctggca caaggctcgtacggcaactgctgcctcggccacgttacagggatgaaggcgaacgtaaag agaaacattgaaagttacaggatgcaggaaacagatggtgattgcaacatcagagctgtt gtgttcctgatgaagaagaagccgttgcataaaactcagaagactcgctgtgctgatcca aatcagggttgggtccaggacgtgattcgcgctgtcattgcgaggaatcagatttag

DBGET integrated database retrieval system