Cottoperca gobio: 115009535 Help Entry 115009535         CDS       T07513                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism cgob  Cottoperca gobio Pathway cgob04010   MAPK signaling pathway cgob04012   ErbB signaling pathway cgob04068   FoxO signaling pathway cgob04137   Mitophagy - animal cgob04140   Autophagy - animal cgob04144   Endocytosis cgob04150   mTOR signaling pathway cgob04210   Apoptosis cgob04218   Cellular senescence cgob04370   VEGF signaling pathway cgob04371   Apelin signaling pathway cgob04510   Focal adhesion cgob04540   Gap junction cgob04625   C-type lectin receptor signaling pathway cgob04810   Regulation of actin cytoskeleton cgob04910   Insulin signaling pathway cgob04912   GnRH signaling pathway cgob04916   Melanogenesis cgob05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgob00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115009535 (hras)    04012 ErbB signaling pathway     115009535 (hras)    04370 VEGF signaling pathway     115009535 (hras)    04371 Apelin signaling pathway     115009535 (hras)    04068 FoxO signaling pathway     115009535 (hras)    04150 mTOR signaling pathway     115009535 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     115009535 (hras)    04140 Autophagy - animal     115009535 (hras)    04137 Mitophagy - animal     115009535 (hras)   09143 Cell growth and death    04210 Apoptosis     115009535 (hras)    04218 Cellular senescence     115009535 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     115009535 (hras)    04540 Gap junction     115009535 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     115009535 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115009535 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     115009535 (hras)    04912 GnRH signaling pathway     115009535 (hras)    04916 Melanogenesis     115009535 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115009535 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cgob04131]     115009535 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgob04147]     115009535 (hras)    04031 GTP-binding proteins [BR:cgob04031]     115009535 (hras) Membrane trafficking [BR:cgob04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     115009535 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     115009535 (hras) Exosome [BR:cgob04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115009535 (hras)   Exosomal proteins of colorectal cancer cells    115009535 (hras) GTP-binding proteins [BR:cgob04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115009535 (hras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  115009535 NCBI-ProteinID:  XP_029289428 Ensembl:  ENSCGOG00000018941 UniProt:  A0A6J2PTD2 LinkDB All DBs Position 6:complement(10980726..10996031) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggagctggaggcgtgggcaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatatgaccccaccatagaggactcttac aggaaacaggttgtgattgacggagagacctgtctgctggacatcttggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgaggacaggggaaggtttcctctgt gtcttcgccatcaacaacaccaagtcttttgaggacattcaccagtacagagaacagatt aaacgtgtaaaggactctgacgatgttcccatggtgcttgtgggaaacaaatgtgatctc ccggcacgtacggtggacacgaggcaagcccaggaacttgcccgctcttacggcatacct tacatcgagacctctgccaaaacacgacagggagtagaggacgccttctacacgctggtt agggagatcagacagcataagctgaggaagctgaacccacctgatgagagcggtcaggac tgtatgagctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system