Cottoperca gobio: 115010838 Help Entry 115010838         CDS       T07513                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism cgob  Cottoperca gobio Pathway cgob03030   DNA replication cgob03410   Base excision repair cgob03420   Nucleotide excision repair cgob03430   Mismatch repair cgob03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cgob00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     115010838 (pold4)    03410 Base excision repair     115010838 (pold4)    03420 Nucleotide excision repair     115010838 (pold4)    03430 Mismatch repair     115010838 (pold4)    03440 Homologous recombination     115010838 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cgob03032]     115010838 (pold4)    03400 DNA repair and recombination proteins [BR:cgob03400]     115010838 (pold4) DNA replication proteins [BR:cgob03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     115010838 (pold4) DNA repair and recombination proteins [BR:cgob03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       115010838 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      115010838 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  115010838 NCBI-ProteinID:  XP_029291537 Ensembl:  ENSCGOG00000001322 UniProt:  A0A6J2Q2Q0 LinkDB All DBs Position 1:complement(24625851..24630944) Genome browser AA seq 108 aa AA seqDB search MTTKHGLITDSFKVVKKAKRRVKREKRPPSPAPHRVTETETVREEELHKLRQFDLDWTFG PCTGISRLQRWERAKLHGLSPLEEIRDLLLQTHTDPEYNLSLWREYPL NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacaaccaagcatggactgataactgattccttcaaggtggtgaagaaagcaaagaga agggtgaagagggagaagaggcctccttctcctgcacctcacagagtgactgaaactgaa acggtgcgagaggaggagctgcacaagctcagacagtttgatctggactggacatttggg ccatgcacagggatcagcaggttgcagagatgggagagagcgaagcttcatggtctgagc ccactagaggagatcagagacctgctgcttcaaacacacactgaccccgagtacaacctg agcctgtggagggaatatcctttgtga

DBGET integrated database retrieval system