Cottoperca gobio: 115011659 Help Entry 115011659         CDS       T07513                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism cgob  Cottoperca gobio Pathway cgob04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cgob00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     115011659  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cgob04121]     115011659    03400 DNA repair and recombination proteins [BR:cgob03400]     115011659 Ubiquitin system [BR:cgob04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      115011659    Cul5 complex      115011659 DNA repair and recombination proteins [BR:cgob03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      115011659 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  115011659 NCBI-ProteinID:  XP_029292706 Ensembl:  ENSCGOG00000005350 UniProt:  A0A6J2Q4R9 LinkDB All DBs Position 8 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQKLYKDDVMLNDGQTLGNC GFTNQTARPQAPATVGLAFRLSDDSFEQLRVESFSTPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctaatgatccgacgtcacaagacgaccatcttcacagatgccaaagag tctaccacagtctatgaacttaagcgcattgtggaaggcattttaaagaggccacctgaa gatcagaaactttacaaggatgacgtgatgcttaatgacggtcaaactcttggaaattgt ggctttacaaatcaaacagcccgacctcaggccccagccacggtgggattagctttccgt ttgagtgatgattcatttgagcagctgagggtcgagtctttctccactcccccagagctc cctgacgtcatgaagccccaggactcgggcagcaccgccaacgagcaggctgtacagtga

DBGET integrated database retrieval system