Cottoperca gobio: 115014742 Help Entry 115014742         CDS       T07513                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism cgob  Cottoperca gobio Pathway cgob04010   MAPK signaling pathway cgob04068   FoxO signaling pathway cgob04081   Hormone signaling cgob04114   Oocyte meiosis cgob04140   Autophagy - animal cgob04150   mTOR signaling pathway cgob04810   Regulation of actin cytoskeleton cgob04910   Insulin signaling pathway cgob04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cgob00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115014742    04068 FoxO signaling pathway     115014742    04150 mTOR signaling pathway     115014742   09133 Signaling molecules and interaction    04081 Hormone signaling     115014742  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115014742   09143 Cell growth and death    04114 Oocyte meiosis     115014742   09142 Cell motility    04810 Regulation of actin cytoskeleton     115014742  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     115014742    04914 Progesterone-mediated oocyte maturation     115014742  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cgob04052]     115014742 Cytokines and neuropeptides [BR:cgob04052]  Neuropeptides   Unclassified    115014742 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  115014742 NCBI-ProteinID:  XP_029297655 UniProt:  A0A6J2QJP7 LinkDB All DBs Position 10:complement(18132988..18133994) Genome browser AA seq 111 aa AA seqDB search MARVPCLVSMLLLLALYSPGVSSAPGQHLCGSQLVDALYFLCGERGFFFSPNRPHKRDLE HLFGFLSKSARQEQRPWRAPSGHEEPKVKRGIVEQCCHKPCSIYHLEGYCN NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtaccatgtttagtgtctatgctgttactgctggcactctactctccaggg gtgtcctcggcccccggccagcacctgtgcggctcccagctggtggacgccctctacttc ctatgtggggaacggggctttttcttcagtccaaacagaccccacaagcgagatctggaa catctgttcgggttcctgtcgaaaagtgccagacaggagcagcggccgtggagggctccg tctgggcatgaagagcccaaggtgaagagaggcatcgtggagcagtgctgccataagcca tgcagcatttaccacctggagggctactgcaactga

DBGET integrated database retrieval system