Cottoperca gobio: 115021881 Help Entry 115021881         CDS       T07513                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism cgob  Cottoperca gobio Pathway cgob04068   FoxO signaling pathway cgob04136   Autophagy - other cgob04140   Autophagy - animal cgob04621   NOD-like receptor signaling pathway cgob04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:cgob00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     115021881 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115021881 (atg12)    04136 Autophagy - other     115021881 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     115021881 (atg12)    04622 RIG-I-like receptor signaling pathway     115021881 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cgob04131]     115021881 (atg12)    04121 Ubiquitin system [BR:cgob04121]     115021881 (atg12)    03029 Mitochondrial biogenesis [BR:cgob03029]     115021881 (atg12) Membrane trafficking [BR:cgob04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     115021881 (atg12) Ubiquitin system [BR:cgob04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    115021881 (atg12) Mitochondrial biogenesis [BR:cgob03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     115021881 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  115021881 NCBI-ProteinID:  XP_029308482 UniProt:  A0A6J2RGD3 LinkDB All DBs Position 16:9238789..9241968 Genome browser AA seq 117 aa AA seqDB search MSDNAESPTETQKEESQPPSDDSTTNDDKKKIDVLLKSVGDTPIMKTKKWAVDRGRTILS LSQFISRFLKLDGSEQLFIYVNQSFAPSPDQEVGILFDCFGSDGKLVLHYCKSQAWG NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaatgcagagtccccaacagaaacgcaaaaagaagagtcacaaccgccgtca gacgattcgacgacaaatgatgataagaaaaaaattgatgtgctgctgaagtcagtggga gacactcctataatgaaaacaaagaagtgggcagtggacagggggaggacgatactgtcc ctgtctcagttcatctcccgcttcctcaagcttgatggcagtgaacaactgttcatttat gttaaccagtctttcgccccctcaccggatcaagaagtagggatcctctttgattgtttt ggcagcgatggcaagctggttctacattactgtaaatctcaagcttggggttaa

DBGET integrated database retrieval system