Cottoperca gobio: 115021888 Help Entry 115021888         CDS       T07513                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism cgob  Cottoperca gobio Pathway cgob04382   Cornified envelope formation cgob05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cgob00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     115021888  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115021888  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cgob04147]     115021888 Exosome [BR:cgob04147]  Exosomal proteins   Exosomal proteins of microglial cells    115021888 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_1 Cas9_REC SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  115021888 NCBI-ProteinID:  XP_029308491 Ensembl:  ENSCGOG00000008160 UniProt:  A0A6J2RE77 LinkDB All DBs Position 16:complement(10430050..10431432) Genome browser AA seq 99 aa AA seqDB search MTELENCMESLITLFHRYADEDGDGSTLSKKELKKLMENELPTFLKCQKNPKTVDNILKD LDQNKDDKLSFEEFLPLIVGLSMACEKCYVLHQKKKSKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgactgagttagagaattgcatggagagcctgattacattgttccaccgctatgccgat gaagatggtgatgggagtaccttaagtaagaaggaactgaaaaaactgatggagaatgag ttgcctaccttcctgaaatgccagaagaaccccaaaactgtggacaacatcttgaaagat ttggaccagaacaaagatgataagttgagctttgaagagtttcttcctctcatcgtcggc ctctcgatggcctgtgagaagtgttacgtgcttcatcaaaagaagaagagcaagaagtga

DBGET integrated database retrieval system