Cottoperca gobio: 115028513 Help Entry 115028513         CDS       T07513                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism cgob  Cottoperca gobio Pathway cgob03030   DNA replication cgob03082   ATP-dependent chromatin remodeling cgob03410   Base excision repair cgob03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cgob00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     115028513 (pole3)    03410 Base excision repair     115028513 (pole3)    03420 Nucleotide excision repair     115028513 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     115028513 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cgob03032]     115028513 (pole3)    03036 Chromosome and associated proteins [BR:cgob03036]     115028513 (pole3)    03400 DNA repair and recombination proteins [BR:cgob03400]     115028513 (pole3) Enzymes [BR:cgob01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      115028513 (pole3) DNA replication proteins [BR:cgob03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     115028513 (pole3) Chromosome and associated proteins [BR:cgob03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     115028513 (pole3) DNA repair and recombination proteins [BR:cgob03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       115028513 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CIS_TMP BUD22 PPP4R2 DUF4746 SpoU_methylase DUF5427 CDC45 RNA_pol_3_Rpc31 PFF1_TM DDHD DUF789 Nop52 Nop14 Motif Other DBs NCBI-GeneID:  115028513 NCBI-ProteinID:  XP_029318205 Ensembl:  ENSCGOG00000007661 UniProt:  A0A6J2S964 LinkDB All DBs Position 3:7213680..7217405 Genome browser AA seq 159 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAGDVLAAMEEMEFERFLEPLREALEVYKKGQKGKKEVSEQKRKDKEKKTDSENDK SREEEEEEEEEEEEERMEEEPEAENEGEEEEEEDEEVEN NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atggcagagagacccgaagatctaaaccttcccaacgcggtgatcacccgcatcatcaag gaggcgctcccagatggggtgaatgtgtcgaaagaagccaggagagccatatcccaagct gccagtgtgtttgtgttgtatgcaacgtcctgtgcaaacaattttgccatgaaagccaaa aggaaaactctgaacgcaggagacgttttggctgcgatggaggaaatggagtttgaacga ttcctggagcctctcagagaagctctggaagtgtacaagaagggccagaaaggaaagaag gaggtgtctgagcagaagcgtaaagacaaagagaaaaagaccgactctgagaacgataag agcagggaggaggaagaggaggaagaggaggaagaggaggaggagcgcatggaggaggaa cctgaagctgagaacgaaggcgaggaggaggaggaggaggatgaggaggtggaaaactga

DBGET integrated database retrieval system