Nakaseomyces glabratus: 2889632 Help Entry 2889632           CDS       T01024                                  Symbol GVI51_J04169 Name (RefSeq) uncharacterized protein   KO K14528   ribonuclease P/MRP protein subunit POP8 [EC:3.1.26.5] Organism cgr  Nakaseomyces glabratus Pathway cgr03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:cgr00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     2889632 (GVI51_J04169)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:cgr03009]     2889632 (GVI51_J04169)    03016 Transfer RNA biogenesis [BR:cgr03016]     2889632 (GVI51_J04169)    03029 Mitochondrial biogenesis [BR:cgr03029]     2889632 (GVI51_J04169) Enzymes [BR:cgr01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      2889632 (GVI51_J04169) Ribosome biogenesis [BR:cgr03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      2889632 (GVI51_J04169) Transfer RNA biogenesis [BR:cgr03016]  Eukaryotic type   5'processing factors    Ribonucrease P     2889632 (GVI51_J04169) Mitochondrial biogenesis [BR:cgr03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     2889632 (GVI51_J04169) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pop8 RNase_P_Rpp14 Alpha_Helical Motif Other DBs NCBI-GeneID:  2889632 NCBI-ProteinID:  XP_447894 UniProt:  Q6FPF0 LinkDB All DBs Position J:430713..431090 Genome browser AA seq 125 aa AA seqDB search MGSTKYKEWQYFLLSIRAESDVDHIDEVTWKQAVSNALRKSHGLFGEQIELYWLKIDNKR AIIKCGFADKDILKTALATYISSTELVGSPLVITMEQEASQLNNLFLPEDDKLWFNKIVE IENGD NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgggatccacaaaatacaaagaatggcaatattttttgctttcaataagagcagagagt gatgttgatcatatcgatgaagttacatggaaacaggcagtatcaaatgctctaagaaag tcacatggattatttggtgagcaaattgagttgtattggttgaaaattgataataagaga gctattatcaaatgtggttttgcagacaaagatatattaaagactgcactggctacatat atatccagtactgagctagttggatctccattagttatcacaatggaacaagaagcgtct caattgaataatttatttctacctgaggatgataaattatggtttaacaaaatagttgaa atagagaatggggactga

DBGET integrated database retrieval system