Nakaseomyces glabratus: 2891173 Help Entry 2891173           CDS       T01024                                  Symbol CBF3D, GVI51_M01265 Name (RefSeq) CBF3D   KO K03094   S-phase kinase-associated protein 1 Organism cgr  Nakaseomyces glabratus Pathway cgr03083   Polycomb repressive complex cgr04111   Cell cycle - yeast cgr04120   Ubiquitin mediated proteolysis cgr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     2891173 (CBF3D)    04120 Ubiquitin mediated proteolysis     2891173 (CBF3D)   09126 Chromosome    03083 Polycomb repressive complex     2891173 (CBF3D)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     2891173 (CBF3D)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cgr04131]     2891173 (CBF3D)    04121 Ubiquitin system [BR:cgr04121]     2891173 (CBF3D)    03036 Chromosome and associated proteins [BR:cgr03036]     2891173 (CBF3D) Membrane trafficking [BR:cgr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     2891173 (CBF3D) Ubiquitin system [BR:cgr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      2891173 (CBF3D)    Cul7 complex      2891173 (CBF3D) Chromosome and associated proteins [BR:cgr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      2891173 (CBF3D)   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      2891173 (CBF3D) SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  2891173 NCBI-ProteinID:  XP_449404 UniProt:  Q9UVW8 F2Z631 LinkDB All DBs Position M:163228..163767 Genome browser AA seq 179 aa AA seqDB search MDKKGKYVVLVSGEGEKFTVEKKIAQRSLLLKNYLNDMHESSLDDEDEEQDEDEDEDDEI VMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDAWDREFLKVDQEMLYEII LAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atggacaagaagggcaagtacgttgtattggtgagtggtgaaggcgagaagttcactgtt gagaagaagattgctcagaggtccttgctgttgaagaattacttgaatgacatgcatgaa agcagtttagatgatgaggacgaggagcaggacgaggacgaggacgaggacgatgagatt gtgatgccggttcccaatgtcaggtcgtctgtgttgcagaaagtgattgagtgggcagaa caccatagggactctaacttcccagacgaggacgatgacgactcgcgtaagtctgctcca gtggatgcctgggaccgtgagttcttgaaagtggaccaggagatgctttacgaaatcata ttagcagccaactacttgaatatcaagccattgctggacgctggttgcaaagttgtcgcg gagatgataagagggaggtccccagaagagatcaggaggactttcaatatagtaaacgat ttcacgcctgaggaagaagcagctatcagacgtgaaaatgaatgggcggaggaccgctaa

DBGET integrated database retrieval system