Nakaseomyces glabratus: 2891312 Help Entry 2891312           CDS       T01024                                  Symbol GVI51_M09251 Name (RefSeq) uncharacterized protein   KO K11344   chromatin modification-related protein EAF6 Organism cgr  Nakaseomyces glabratus Pathway cgr03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:cgr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     2891312 (GVI51_M09251)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cgr03036]     2891312 (GVI51_M09251) Chromosome and associated proteins [BR:cgr03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      2891312 (GVI51_M09251)     HBO1 complex      2891312 (GVI51_M09251)     MOZ/MORF complex      2891312 (GVI51_M09251)     NuA4 complex      2891312 (GVI51_M09251) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NuA4 BRE1 DUF3450 GrpE DivIC DUF1319 DUF7307 MinE FapA ZapA Motif Other DBs NCBI-GeneID:  2891312 NCBI-ProteinID:  XP_449748 UniProt:  Q6FJ46 LinkDB All DBs Position M:935679..935954 Genome browser AA seq 91 aa AA seqDB search MSDEYQSVKQELKALLADRKELEDKLDKLQQEIYDKESEYFDVDGGSKSYHNILRGFDGM SRTQSNNSNMTNNDRIFSLSSASYVKQVQDQ NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagtgatgagtatcagtctgtgaagcaggagctgaaggctcttcttgctgaccggaag gagcttgaggacaagctggacaagttgcagcaggagatatacgacaaggagagcgagtat tttgatgttgacggcggttcgaagagctaccacaatatccttcgtgggtttgacggcatg agcaggactcagagcaacaactcgaacatgacgaacaacgacagaatcttctctctgagc agtgcgagctatgtgaagcaagtgcaagaccagtga

DBGET integrated database retrieval system