Nakaseomyces glabratus: 2891739 Help Entry 2891739           CDS       T01024                                  Symbol GVI51_M07821 Name (RefSeq) uncharacterized protein   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism cgr  Nakaseomyces glabratus Pathway cgr03018   RNA degradation cgr03040   Spliceosome Brite KEGG Orthology (KO) [BR:cgr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     2891739 (GVI51_M07821)   09123 Folding, sorting and degradation    03018 RNA degradation     2891739 (GVI51_M07821)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cgr03019]     2891739 (GVI51_M07821)    03041 Spliceosome [BR:cgr03041]     2891739 (GVI51_M07821) Messenger RNA biogenesis [BR:cgr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      2891739 (GVI51_M07821)   mRNA degradation factors    5'-3' decay     Lsm complex      2891739 (GVI51_M07821) Spliceosome [BR:cgr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     2891739 (GVI51_M07821) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM QRPTase_N Motif Other DBs NCBI-GeneID:  2891739 NCBI-ProteinID:  XP_449688 UniProt:  Q6FJA6 LinkDB All DBs Position M:794951..795268 Genome browser AA seq 105 aa AA seqDB search MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKIRLLRGSEIVVCGLLED AKALEGLPMDSHVYKDTKNVIKDEYLIWEAVNKKHQSTHKKRKLK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgtcgcctttattgaagcagtacttgaacaaagacatagtggtagtgaccacagctggt gaagtgatgcatgtcgttttggatggttacgataaatacacaaaccttgtggtcaaagaa ggagacaagatcagacttctgcgaggtagtgagatagttgtgtgcgggttgttagaagat gcaaaagcactagaagggctgccgatggattcacatgtctataaggacacgaagaatgtt atcaaggatgagtatctgatatgggaagctgtaaataagaaacatcaatctacacataag aagaggaaactcaaatga

DBGET integrated database retrieval system