Nakaseomyces glabratus: 9488012 Help Entry 9488012           CDS       T01024                                  Symbol GVI51_I07667 Name (RefSeq) uncharacterized protein   KO K11511   centromere protein S Organism cgr  Nakaseomyces glabratus Pathway cgr03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:cgr00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     9488012 (GVI51_I07667)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cgr03036]     9488012 (GVI51_I07667)    03400 DNA repair and recombination proteins [BR:cgr03400]     9488012 (GVI51_I07667) Chromosome and associated proteins [BR:cgr03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      9488012 (GVI51_I07667) DNA repair and recombination proteins [BR:cgr03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      9488012 (GVI51_I07667) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-18kDa Bromo_TP Motif Other DBs NCBI-GeneID:  9488012 NCBI-ProteinID:  XP_002999561 UniProt:  B4UN18 LinkDB All DBs Position I:757363..757692 Genome browser AA seq 109 aa AA seqDB search MAGGYKLQSYKATKLQSYKGTSEAMDESQLKGKLWYCVDRLLAREERRFSQKFVSALVEL VYVQLVEVGETLESYAQHGGRDVVSMADLRLLLRRSPELLAMCDPEGSQ NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggcaggcgggtacaagctacaaagctacaaagctacaaagctacaaagctacaaaggc acaagtgaggcgatggacgagtcgcagttgaaagggaagttgtggtactgtgtggaccgg ctgcttgcgcgggaggagcggcggttcagccagaagttcgtgagcgcgctggtggagctc gtgtatgtgcaactcgttgaggtcggcgagacgttggagagctacgcgcagcacggtggc cgggacgtggtgagcatggctgatctgcggctgttgctgcggcggtcgcccgagctgctg gctatgtgtgaccctgagggtagccagtga

DBGET integrated database retrieval system