Campylobacter gracilis: CGRAC_1535 Help Entry CGRAC_1535        CDS       T04020                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cgra  Campylobacter gracilis Pathway cgra01100   Metabolic pathways cgra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cgra00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CGRAC_1535 (acpP)    00074 Mycolic acid biosynthesis     CGRAC_1535 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CGRAC_1535 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AKT92970 LinkDB All DBs Position complement(1593379..1593615) Genome browser AA seq 78 aa AA seqDB search MAVFEDVRDVVVEQLSVSPDQVKLDSKIIEDLGADSLDVVELVMALEEKFGIEIPDSESE KLVSIKDVVDYIENLPKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgaagatgtaagagacgtagttgtagaacaactaagcgttagcccggat caggttaaacttgactctaaaattatcgaggatttgggcgcggactctcttgacgtagtt gagctagtaatggctttagaggagaaattcggtatcgagatccctgatagcgagtccgaa aaattagtaagcattaaagacgtagtagattatatagaaaatttgcctaagaaataa

DBGET integrated database retrieval system