Corynebacterium glutamicum R: cgR_1107 Help Entry cgR_1107          CDS       T00501                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism cgt  Corynebacterium glutamicum R Pathway cgt03430   Mismatch repair Brite KEGG Orthology (KO) [BR:cgt00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     cgR_1107  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cgt03400]     cgR_1107 Enzymes [BR:cgt01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      cgR_1107 DNA repair and recombination proteins [BR:cgt03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      cgR_1107 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Motif Other DBs NCBI-ProteinID:  BAF54084 UniProt:  A0AB72VB69 LinkDB All DBs Position complement(1218206..1218451) Genome browser AA seq 81 aa AA seqDB search MTNPDIVGSGQGNDSFEPVAQLSYERARDELVEIVKILELGQMGLDESLKYWERGEALAK RCEEHLAGASARVEQALNQAE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccagatatcgtcggttccggccaaggcaacgattccttcgagccagtcgcc caattatcctacgaacgcgcccgcgacgaactcgtggaaatcgtgaaaattttggagctc ggccaaatgggcctcgacgaatccctcaaatactgggagcgcggcgaagccctagcaaag cgctgcgaagagcacctggccggcgcctcagcgcgcgtcgagcaagcattaaaccaggca gaataa

DBGET integrated database retrieval system