Corynebacterium glutamicum R: cgR_1654 Help Entry cgR_1654          CDS       T00501                                  Name (GenBank) hypothetical protein   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism cgt  Corynebacterium glutamicum R Pathway cgt03020   RNA polymerase Brite KEGG Orthology (KO) [BR:cgt00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     cgR_1654  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cgt03021]     cgR_1654    03400 DNA repair and recombination proteins [BR:cgt03400]     cgR_1654 Enzymes [BR:cgt01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      cgR_1654 Transcription machinery [BR:cgt03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      cgR_1654 DNA repair and recombination proteins [BR:cgt03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       cgR_1654 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  BAF54646 UniProt:  A0AB72VB86 LinkDB All DBs Position complement(1840190..1840477) Genome browser AA seq 95 aa AA seqDB search MTNVSNETNATKAVFDPPVGITAPPIDELLDKVTSKYALVIFAAKRARQINSFYHQADEG VFEFIGPLVTPQPGEKPLSIALREINAGLLDHEEG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt gtgaccaacgtgagcaacgagaccaacgccaccaaggccgtcttcgatccgccagtgggc attaccgctcctccgatcgatgaactgctggataaggtcacttccaagtacgccctcgtg atcttcgcagccaagcgtgcgcgccagatcaacagcttctaccatcaggcagatgaggga gtattcgagttcatcggaccattggttactccgcagccaggcgaaaagccactttctatt gctctgcgtgagatcaatgcaggtctgttggaccacgaggaaggttaa

DBGET integrated database retrieval system