Corynebacterium glyciniphilum: CGLY_13460 Help Entry CGLY_13460        CDS       T03073                                  Name (GenBank) Putative membrane protein   KO K03116   sec-independent protein translocase protein TatA Organism cgy  Corynebacterium glyciniphilum Pathway cgy03060   Protein export cgy03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:cgy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CGLY_13460  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CGLY_13460  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:cgy02044]     CGLY_13460 Secretion system [BR:cgy02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CGLY_13460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AHW65132 UniProt:  X5DWX1 LinkDB All DBs Position complement(2912785..2913033) Genome browser AA seq 82 aa AA seqDB search MLQNLTGMHALVILAVVLLLFGAAKLPALATSVGQSVRILKKEASETEPDAVPVAAPVTE ATPSVHTVHTVPTAPTAEQHTS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgttacagaatctcaccggaatgcacgccctggtcatcctcgccgtcgtgctcctgctg ttcggggcggcgaagctccccgcgctggccacaagcgtcggccagtctgtccggatcctg aagaaggaagcctccgagacagagcccgatgctgtgccggtggccgcaccggttacggaa gccacgccgtccgtgcacaccgtgcataccgtgccaacggcccccacggcagaacagcac acctcatga

DBGET integrated database retrieval system