Chromobacterium haemolyticum: CH06BL_31790 Help Entry CH06BL_31790      CDS       T06734                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism chae  Chromobacterium haemolyticum Pathway chae02020   Two-component system chae02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:chae00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     CH06BL_31790  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     CH06BL_31790  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:chae02035]     CH06BL_31790 Bacterial motility proteins [BR:chae02035]  Flagellar system   Flagellar assembly proteins    Others     CH06BL_31790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  BBH13931 LinkDB All DBs Position complement(3500482..3500751) Genome browser AA seq 89 aa AA seqDB search MQINSTSSQRRELAVGGQSAAAETPARAPASVAAPAASQDMAPAVAELRALPDIDMKRVE EVRAALARGEVRFDAARLADLVEQYHRSR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcaaatcaactcgacctcgtcgcaacgccgcgaactggcggtcggcggccagagcgcc gccgcggaaacgccggcccgcgcgcccgcgtccgtcgccgcgcccgccgcgagccaggac atggcgccggcggtggcggagctgcgcgcgctgccggacatcgacatgaaacgggtggaa gaagtgcgtgccgcgctagcgcgcggcgaagtgcgcttcgacgccgcccggctggccgac ctggtggagcaatatcaccggagccgctga

DBGET integrated database retrieval system