Chromobacterium haemolyticum: CH06BL_34780
Help
Entry
CH06BL_34780 CDS
T06734
Symbol
phnC1
Name
(GenBank) phosphonates import ATP-binding protein PhnC 1
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
chae
Chromobacterium haemolyticum
Pathway
chae02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
chae00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
CH06BL_34780 (phnC1)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
chae02000
]
CH06BL_34780 (phnC1)
Enzymes [BR:
chae01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
CH06BL_34780 (phnC1)
Transporters [BR:
chae02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
CH06BL_34780 (phnC1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
nSTAND1
AAA_29
RsgA_GTPase
AAA_25
Motif
Other DBs
NCBI-ProteinID:
BBH14230
LinkDB
All DBs
Position
3849556..3850353
Genome browser
AA seq
265 aa
AA seq
DB search
MSLEFHDAGLKLDGAVILRGITLRLAAGEQAALIGPSGAGKSSLLLLANTGLRPDAGEVR
LLGANPWRLPRRALRALRARIGSIYQTPPLPPRQRVIHAVAAGRLGHSGELAALLRLLWP
DDAAGVAAELERLGLSDKLWQRCDQLSGGQRQRVGIARALYQRPELLLADEPVSALDPRL
ADDTIRLLCEDARARRAALLVSLHSVQLALEHFPRIIGLRDGAIAFDLPREQVDSALLTE
LYSGDSPDAAMEAAAPATALRGLQC
NT seq
798 nt
NT seq
+upstream
nt +downstream
nt
gtgagcctggagttccacgacgcaggcctgaagctggacggcgccgtcatcctgcgcggt
ataacgctgcgcctggccgccggcgagcaagcggccttgatcgggccgtccggcgccggc
aagagttcgctgctgctgctggccaacaccggcctgcgcccggacgccggcgaggtccgg
ctgctgggcgccaacccctggcgcctgccgcgccgcgccctgcgcgccttgcgcgcgcgc
atcggcagtatctatcagacgccgccgctgcctccgcgccagcgggtgatccatgcggtg
gcggccggcaggctgggccatagcggcgaactggcggccctgctccggctgctgtggccg
gacgacgccgccggcgtcgccgccgaactggaacggctgggcctgtccgacaaactgtgg
cagcgctgcgaccagctgtccggcggccagcgccagcgcgtcggcatcgcccgcgcgctg
taccagcgcccggaacttttgctggccgacgaacccgtgtcggcgttggaccccaggctg
gccgacgacaccattcgcctgctgtgcgaggacgcccgcgcgcgccgcgccgcgcttctg
gtcagcctgcactcggtgcaactggccttggagcacttcccgcgcatcatcggcctgcgc
gacggcgcgatcgccttcgacttgccgcgcgaacaggtcgactccgcgctgctgaccgaa
ctctactccggcgactcgcctgacgcggcgatggaagcggccgcgcccgccaccgcgctc
agaggcctgcaatgctga
DBGET
integrated database retrieval system