Chromobacterium haemolyticum: CH06BL_35490 Help Entry CH06BL_35490      CDS       T06734                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism chae  Chromobacterium haemolyticum Pathway chae01100   Metabolic pathways chae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:chae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CH06BL_35490 (acpP)    00074 Mycolic acid biosynthesis     CH06BL_35490 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CH06BL_35490 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Raf1_N ATP-grasp_2 Motif Other DBs NCBI-ProteinID:  BBH14301 LinkDB All DBs Position complement(3923179..3923424) Genome browser AA seq 81 aa AA seqDB search MTREQILNELRIILQDTFEIEPQRVTAEANLFVDLELDSIDAVDLAIKLQQLTGKRIKPD GFKTVRTVDDVITAVEQLLAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacccgtgagcaaattttgaatgaactgaggatcattctacaggacactttcgagatc gaaccgcaacgcgtgacggcggaggccaatctgttcgtcgacctggagctggactccatc gacgcggtggacctggcgatcaagctgcagcagttgaccggcaagcgcatcaagccggac ggattcaaaacggtgcgcaccgtggatgacgtgatcaccgcggttgagcaattgctggcc gcctga

DBGET integrated database retrieval system