KEGG   Chromobacterium haemolyticum: CH06BL_39360
Entry
CH06BL_39360      CDS       T06734                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
chae  Chromobacterium haemolyticum
Pathway
chae00190  Oxidative phosphorylation
chae01100  Metabolic pathways
chae02020  Two-component system
Module
chae_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:chae00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CH06BL_39360 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CH06BL_39360 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    CH06BL_39360 (petA)
Enzymes [BR:chae01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     CH06BL_39360 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske
Other DBs
NCBI-ProteinID: BBH14688
LinkDB
Position
complement(4322416..4323000)
AA seq 194 aa
MSEQQVDAGRRRFLTVATSAVGGVAAAGVATPFLMSFFPSERAKAAGAPVEVDIGKIEPG
QKINVEWRGKPVWVLNRTPEQLKNLPKLDEKLVDPKSEMDQQPTYCQNEHRSIKPELLVA
VGICTHLGCSPTHRPDIAPADLGPDWLGGFYCPCHGSKFDLAARVYKGVPAPKNLEIPPH
KYLSDTRLLIGEDK
NT seq 585 nt   +upstreamnt  +downstreamnt
atgagtgaacaacaagtcgatgcggggcgccgtcgctttctgacggttgcaaccagcgct
gttggtggtgtggcggcggccggagtggctacgccgtttctgatgagtttcttcccgtcc
gagagggcaaaggccgccggcgctcccgtcgaggtggatatcggcaagatcgagccgggc
cagaagatcaacgtcgaatggcgcggcaagccggtatgggtgctgaaccgcacgccggag
caattgaaaaacctgccgaagctggacgagaagctggttgatcccaaatccgagatggat
cagcagcctacttattgccagaacgagcaccgctcgatcaaacccgagttgctggttgcc
gtcggcatctgtacgcatttgggctgttcgccgacccaccgtccggatatcgcgcccgcc
gatctgggcccggactggttgggtggcttctactgcccctgtcatggttccaagttcgac
ttggccgcgcgcgtttacaaaggcgtgccggcaccgaagaatctggaaattccgccgcac
aaatatctgtccgacacccgcctgctgattggcgaagacaaataa

DBGET integrated database retrieval system